SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B8N237 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B8N237
Domain Number 1 Region: 178-355
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 3.14e-19
Family Galactose oxidase, central domain 0.013
Further Details:      
 
Domain Number 2 Region: 15-164
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.000000824
Family Integrin alpha N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B8N237
Sequence length 359
Comment (tr|A0A0B8N237|A0A0B8N237_9NOCA) Uncharacterized protein {ECO:0000313|EMBL:GAM45915.1} KW=Complete proteome; Reference proteome OX=37332 OS=Nocardia seriolae. GN=NS07_v2contig00021-0022 OC=Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Nocardia.
Sequence
MANVAGQFVPIPDWFSADNQDCGLAIADLGGDGTLDAVILIVDNPPGQNTGNYRVGHGLA
ADGTVGQWGPWLEVPDRWGWENQGAGMTVADLDGDGRPELIVFAVDHPQNGNAGLYTIGW
GLDGSGHCVDGWSRWSQVPGWGFQENEGAAIASLPGTGGLPRLAVCTIDHPRDGSAGYLR
TLDLDTDLDTAATEGTWRVLDFGTEINPVHAALLYTGDVLFFAGSGNDPDRLNAHDFRTR
VWHYPNPGLAAPVTPIDLFCTGQAFLPDGRLLAVGGTRQYDPFYGLRDALLFDPRTLTWT
AQPDMSYGRWYPTLTALKNGAVLAVSGLGEEGFLSETPEIFDPATMSWSNLPVPGPIPM
Download sequence
Identical sequences A0A0B8N237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]