SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B8NEH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0B8NEH1
Domain Number - Region: 24-130
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000157
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B8NEH1
Sequence length 193
Comment (tr|A0A0B8NEH1|A0A0B8NEH1_9NOCA) Uncharacterized protein {ECO:0000313|EMBL:GAM50180.1} KW=Complete proteome; Reference proteome OX=37332 OS=Nocardia seriolae. GN=NS07_v2contig00140-0027 OC=Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Nocardia.
Sequence
MTAPDDLQDMLPVPQTVARPVVDWGAVERQVGTALPEDYKRLVDTYGESEFSSIVRLSVP
NATAPSLDLAGWIRDARERLENPDLPPECDHIPDGFTLDPQSLTAWGKLADGGYCLWHST
GADPNAWPIVVGSKTHSRWGFYEGTATEFLKAMLTQTLPPQRLFDEFADMVDEFGIYCDF
YFHGRKIGTVDAD
Download sequence
Identical sequences A0A0B8NEH1
WP_033087755.1.16711 WP_033087755.1.19107 WP_033087755.1.21898 WP_033087755.1.59143 WP_033087755.1.64874 WP_033087755.1.72417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]