SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B8NR78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B8NR78
Domain Number 1 Region: 81-205
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000137
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B8NR78
Sequence length 243
Comment (tr|A0A0B8NR78|A0A0B8NR78_9NOCA) Uncharacterized protein {ECO:0000313|EMBL:GAM50773.1} KW=Complete proteome; Reference proteome OX=37332 OS=Nocardia seriolae. GN=NS07_v2contig00173-0016 OC=Bacteria; Actinobacteria; Corynebacteriales; Nocardiaceae; Nocardia.
Sequence
MGHVDDLGFLAVPASSELTAAKTAKDIRSQTMATPHDALLDLRRAASAGLLDLDGSGPAS
REAVRVRETLLVQHFGTVAWSVPPSYRALLAEHNRLRCHREEGEREFVLVDEGEIVGLNA
ELVHMPEGVSREPGRYLSTGHLVGFAEAGYEAVWCFDVAQPGGDGEYPVYYHHQDEPRAR
YLADGAWEERADAVPDFPSFAAWFEAMAAAFTSAQPPVWFDEMGTPALVWLAREGIFQAC
GQY
Download sequence
Identical sequences A0A0B8NR78

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]