SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B8QQN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B8QQN6
Domain Number 1 Region: 27-87,120-206
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000249
Family SMI1/KNR4-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B8QQN6
Sequence length 208
Comment (tr|A0A0B8QQN6|A0A0B8QQN6_LISMN) Uncharacterized protein {ECO:0000313|EMBL:GAM95184.1} KW=Complete proteome OX=1639 OS=Listeria monocytogenes. GN=LmNIHS28_01116 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MMADLQDRLARIQAKITALKEKDPDLNLFGSESHAYKLNQPLSNQTLTEFENEHQITLPQ
DYRAFLEQIGNGGMGPYYGLETLADGLCASLDYKDEKYGVQTLSEPFPHTDDWTAPGYKE
GMSDEDYDAWQELCFQDKEVFGLLRIANFGCGVSINLVVNGPSYGEIWVDDRNNDNGVYP
DFYFGNEERLGFLEWYELWLDKSIEEIE
Download sequence
Identical sequences A0A0B8QQN6 A0A0E1R2D1
gi|424713143|ref|YP_007013858.1| gi|405751495|ref|YP_006674960.1| 265669.LMOf2365_0290 gi|46906511|ref|YP_012900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]