SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B8QYA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B8QYA4
Domain Number 1 Region: 33-157
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000628
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B8QYA4
Sequence length 161
Comment (tr|A0A0B8QYA4|A0A0B8QYA4_LISMN) SMI1/KNR4 family protein {ECO:0000313|EMBL:PMR07048.1} KW=Complete proteome OX=1639 OS=Listeria monocytogenes. GN=A7B02_10525 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Listeriaceae; Listeria.
Sequence
MEPINHFFEWAKNNNWQVDLSAVEKNLPEQILKRYGKLPDAYKAFYRQLNLCSNVGDTCW
FLLEEDFLENEDDAFSWNSFEQMSLEAAEGDTNLENEVKLFWNAHLPIMMSVGGCYEYYA
ITLNDGNIVHGSEPEFEESSIVADSFADFLLKIVAGEIVIS
Download sequence
Identical sequences A0A0B8QYA4 A0A0E1R4Q7
gi|525735429|ref|YP_008289105.1| gi|46907133|ref|YP_013522.1| 265669.LMOf2365_0920 gi|405749256|ref|YP_006672722.1| WP_003724827.1.100160 WP_003724827.1.100221 WP_003724827.1.100261 WP_003724827.1.100458 WP_003724827.1.100522 WP_003724827.1.10073 WP_003724827.1.101093 WP_003724827.1.101688 WP_003724827.1.101811 WP_003724827.1.10182 WP_003724827.1.10210 WP_003724827.1.102150 WP_003724827.1.10418 WP_003724827.1.10460 WP_003724827.1.11086 WP_003724827.1.1146 WP_003724827.1.1160 WP_003724827.1.11689 WP_003724827.1.11788 WP_003724827.1.12020 WP_003724827.1.12287 WP_003724827.1.12417 WP_003724827.1.12993 WP_003724827.1.13004 WP_003724827.1.13180 WP_003724827.1.13329 WP_003724827.1.13360 WP_003724827.1.13684 WP_003724827.1.13779 WP_003724827.1.13855 WP_003724827.1.14072 WP_003724827.1.14103 WP_003724827.1.14339 WP_003724827.1.14641 WP_003724827.1.14875 WP_003724827.1.15122 WP_003724827.1.15340 WP_003724827.1.15342 WP_003724827.1.15495 WP_003724827.1.15518 WP_003724827.1.15564 WP_003724827.1.15618 WP_003724827.1.1575 WP_003724827.1.16403 WP_003724827.1.16516 WP_003724827.1.1667 WP_003724827.1.16746 WP_003724827.1.1678 WP_003724827.1.1688 WP_003724827.1.17106 WP_003724827.1.17131 WP_003724827.1.17398 WP_003724827.1.17399 WP_003724827.1.17774 WP_003724827.1.18289 WP_003724827.1.18721 WP_003724827.1.19112 WP_003724827.1.19167 WP_003724827.1.19195 WP_003724827.1.19246 WP_003724827.1.19372 WP_003724827.1.19443 WP_003724827.1.19452 WP_003724827.1.19472 WP_003724827.1.19542 WP_003724827.1.19584 WP_003724827.1.19607 WP_003724827.1.19685 WP_003724827.1.19901 WP_003724827.1.20263 WP_003724827.1.20672 WP_003724827.1.21338 WP_003724827.1.21371 WP_003724827.1.21428 WP_003724827.1.21527 WP_003724827.1.21529 WP_003724827.1.21542 WP_003724827.1.21567 WP_003724827.1.21597 WP_003724827.1.21874 WP_003724827.1.22099 WP_003724827.1.22188 WP_003724827.1.22221 WP_003724827.1.22468 WP_003724827.1.23060 WP_003724827.1.23291 WP_003724827.1.233 WP_003724827.1.23425 WP_003724827.1.23781 WP_003724827.1.23828 WP_003724827.1.23848 WP_003724827.1.24048 WP_003724827.1.24075 WP_003724827.1.24115 WP_003724827.1.24411 WP_003724827.1.24422 WP_003724827.1.24600 WP_003724827.1.24847 WP_003724827.1.24934 WP_003724827.1.24975 WP_003724827.1.25300 WP_003724827.1.25456 WP_003724827.1.25616 WP_003724827.1.25746 WP_003724827.1.25896 WP_003724827.1.26170 WP_003724827.1.26322 WP_003724827.1.2666 WP_003724827.1.26957 WP_003724827.1.27132 WP_003724827.1.27143 WP_003724827.1.27669 WP_003724827.1.27826 WP_003724827.1.27860 WP_003724827.1.27891 WP_003724827.1.27948 WP_003724827.1.28060 WP_003724827.1.28818 WP_003724827.1.29558 WP_003724827.1.29562 WP_003724827.1.29565 WP_003724827.1.29569 WP_003724827.1.29634 WP_003724827.1.30124 WP_003724827.1.30273 WP_003724827.1.30660 WP_003724827.1.30837 WP_003724827.1.30851 WP_003724827.1.31305 WP_003724827.1.31329 WP_003724827.1.31966 WP_003724827.1.3206 WP_003724827.1.32061 WP_003724827.1.32140 WP_003724827.1.32240 WP_003724827.1.32597 WP_003724827.1.32698 WP_003724827.1.32767 WP_003724827.1.32817 WP_003724827.1.33016 WP_003724827.1.3314 WP_003724827.1.33282 WP_003724827.1.3393 WP_003724827.1.34369 WP_003724827.1.34698 WP_003724827.1.34714 WP_003724827.1.34790 WP_003724827.1.3511 WP_003724827.1.35452 WP_003724827.1.35738 WP_003724827.1.35979 WP_003724827.1.36108 WP_003724827.1.36115 WP_003724827.1.3613 WP_003724827.1.36749 WP_003724827.1.37023 WP_003724827.1.37466 WP_003724827.1.37723 WP_003724827.1.37900 WP_003724827.1.37951 WP_003724827.1.38382 WP_003724827.1.38396 WP_003724827.1.384 WP_003724827.1.38575 WP_003724827.1.38741 WP_003724827.1.38819 WP_003724827.1.3892 WP_003724827.1.39000 WP_003724827.1.39348 WP_003724827.1.39496 WP_003724827.1.39794 WP_003724827.1.39871 WP_003724827.1.39895 WP_003724827.1.40245 WP_003724827.1.404 WP_003724827.1.40420 WP_003724827.1.40556 WP_003724827.1.40841 WP_003724827.1.41023 WP_003724827.1.41222 WP_003724827.1.41337 WP_003724827.1.4166 WP_003724827.1.41700 WP_003724827.1.41970 WP_003724827.1.42089 WP_003724827.1.42310 WP_003724827.1.42317 WP_003724827.1.42339 WP_003724827.1.42525 WP_003724827.1.42564 WP_003724827.1.42926 WP_003724827.1.42994 WP_003724827.1.43135 WP_003724827.1.43304 WP_003724827.1.43350 WP_003724827.1.43768 WP_003724827.1.43807 WP_003724827.1.43916 WP_003724827.1.44092 WP_003724827.1.44161 WP_003724827.1.44230 WP_003724827.1.44596 WP_003724827.1.44703 WP_003724827.1.44749 WP_003724827.1.44806 WP_003724827.1.4503 WP_003724827.1.45512 WP_003724827.1.45541 WP_003724827.1.4562 WP_003724827.1.45778 WP_003724827.1.4578 WP_003724827.1.4587 WP_003724827.1.45883 WP_003724827.1.45893 WP_003724827.1.46277 WP_003724827.1.4642 WP_003724827.1.46425 WP_003724827.1.46456 WP_003724827.1.46566 WP_003724827.1.46725 WP_003724827.1.46834 WP_003724827.1.47001 WP_003724827.1.47075 WP_003724827.1.47431 WP_003724827.1.4753 WP_003724827.1.47759 WP_003724827.1.47952 WP_003724827.1.47979 WP_003724827.1.48007 WP_003724827.1.48161 WP_003724827.1.48163 WP_003724827.1.48175 WP_003724827.1.48235 WP_003724827.1.48440 WP_003724827.1.48441 WP_003724827.1.48854 WP_003724827.1.49390 WP_003724827.1.49458 WP_003724827.1.49507 WP_003724827.1.4974 WP_003724827.1.49754 WP_003724827.1.50063 WP_003724827.1.50073 WP_003724827.1.50288 WP_003724827.1.50862 WP_003724827.1.51493 WP_003724827.1.51980 WP_003724827.1.52290 WP_003724827.1.52371 WP_003724827.1.52420 WP_003724827.1.52782 WP_003724827.1.52829 WP_003724827.1.53193 WP_003724827.1.53426 WP_003724827.1.53536 WP_003724827.1.53870 WP_003724827.1.53877 WP_003724827.1.54505 WP_003724827.1.54506 WP_003724827.1.54508 WP_003724827.1.54884 WP_003724827.1.55068 WP_003724827.1.5514 WP_003724827.1.5538 WP_003724827.1.55386 WP_003724827.1.55423 WP_003724827.1.55494 WP_003724827.1.55850 WP_003724827.1.56566 WP_003724827.1.5671 WP_003724827.1.57106 WP_003724827.1.57228 WP_003724827.1.57536 WP_003724827.1.57913 WP_003724827.1.58 WP_003724827.1.58083 WP_003724827.1.58491 WP_003724827.1.58516 WP_003724827.1.58966 WP_003724827.1.59113 WP_003724827.1.59353 WP_003724827.1.59542 WP_003724827.1.59720 WP_003724827.1.59744 WP_003724827.1.59975 WP_003724827.1.60132 WP_003724827.1.60543 WP_003724827.1.60674 WP_003724827.1.60762 WP_003724827.1.60766 WP_003724827.1.60768 WP_003724827.1.61072 WP_003724827.1.611 WP_003724827.1.61274 WP_003724827.1.61358 WP_003724827.1.61371 WP_003724827.1.61824 WP_003724827.1.61915 WP_003724827.1.6236 WP_003724827.1.62375 WP_003724827.1.62494 WP_003724827.1.6281 WP_003724827.1.63209 WP_003724827.1.63315 WP_003724827.1.63605 WP_003724827.1.64147 WP_003724827.1.64587 WP_003724827.1.64796 WP_003724827.1.64929 WP_003724827.1.65143 WP_003724827.1.65561 WP_003724827.1.65780 WP_003724827.1.66057 WP_003724827.1.66138 WP_003724827.1.66285 WP_003724827.1.66596 WP_003724827.1.66743 WP_003724827.1.66993 WP_003724827.1.67551 WP_003724827.1.67573 WP_003724827.1.67654 WP_003724827.1.67926 WP_003724827.1.68208 WP_003724827.1.68236 WP_003724827.1.68282 WP_003724827.1.68517 WP_003724827.1.68525 WP_003724827.1.69263 WP_003724827.1.69603 WP_003724827.1.6991 WP_003724827.1.69989 WP_003724827.1.70100 WP_003724827.1.70122 WP_003724827.1.7026 WP_003724827.1.70373 WP_003724827.1.70590 WP_003724827.1.70633 WP_003724827.1.70736 WP_003724827.1.71381 WP_003724827.1.71437 WP_003724827.1.71474 WP_003724827.1.71726 WP_003724827.1.7175 WP_003724827.1.71763 WP_003724827.1.71858 WP_003724827.1.71904 WP_003724827.1.72264 WP_003724827.1.72546 WP_003724827.1.72623 WP_003724827.1.72918 WP_003724827.1.73152 WP_003724827.1.73263 WP_003724827.1.73448 WP_003724827.1.73508 WP_003724827.1.73613 WP_003724827.1.74148 WP_003724827.1.74436 WP_003724827.1.74617 WP_003724827.1.74728 WP_003724827.1.74823 WP_003724827.1.74927 WP_003724827.1.7504 WP_003724827.1.75216 WP_003724827.1.7553 WP_003724827.1.7565 WP_003724827.1.75838 WP_003724827.1.75869 WP_003724827.1.76247 WP_003724827.1.76254 WP_003724827.1.76367 WP_003724827.1.76545 WP_003724827.1.76982 WP_003724827.1.7718 WP_003724827.1.77222 WP_003724827.1.77261 WP_003724827.1.77345 WP_003724827.1.7738 WP_003724827.1.77594 WP_003724827.1.77675 WP_003724827.1.77697 WP_003724827.1.77849 WP_003724827.1.77928 WP_003724827.1.77943 WP_003724827.1.78088 WP_003724827.1.78315 WP_003724827.1.78328 WP_003724827.1.78681 WP_003724827.1.78717 WP_003724827.1.79128 WP_003724827.1.79149 WP_003724827.1.79821 WP_003724827.1.80693 WP_003724827.1.80968 WP_003724827.1.81140 WP_003724827.1.81270 WP_003724827.1.81315 WP_003724827.1.81476 WP_003724827.1.81495 WP_003724827.1.8151 WP_003724827.1.82294 WP_003724827.1.82480 WP_003724827.1.82605 WP_003724827.1.82821 WP_003724827.1.82974 WP_003724827.1.83015 WP_003724827.1.83130 WP_003724827.1.83755 WP_003724827.1.83809 WP_003724827.1.83877 WP_003724827.1.83907 WP_003724827.1.8391 WP_003724827.1.84180 WP_003724827.1.8465 WP_003724827.1.84895 WP_003724827.1.84974 WP_003724827.1.85036 WP_003724827.1.85194 WP_003724827.1.85317 WP_003724827.1.8539 WP_003724827.1.85576 WP_003724827.1.85690 WP_003724827.1.85890 WP_003724827.1.86098 WP_003724827.1.86232 WP_003724827.1.86279 WP_003724827.1.86571 WP_003724827.1.86683 WP_003724827.1.8715 WP_003724827.1.87179 WP_003724827.1.87294 WP_003724827.1.87329 WP_003724827.1.87436 WP_003724827.1.87903 WP_003724827.1.88055 WP_003724827.1.88211 WP_003724827.1.88397 WP_003724827.1.88422 WP_003724827.1.88463 WP_003724827.1.88639 WP_003724827.1.88783 WP_003724827.1.88800 WP_003724827.1.88895 WP_003724827.1.89014 WP_003724827.1.89302 WP_003724827.1.89387 WP_003724827.1.89505 WP_003724827.1.89812 WP_003724827.1.89916 WP_003724827.1.90326 WP_003724827.1.90524 WP_003724827.1.90646 WP_003724827.1.90857 WP_003724827.1.90963 WP_003724827.1.91084 WP_003724827.1.91443 WP_003724827.1.91560 WP_003724827.1.91920 WP_003724827.1.91922 WP_003724827.1.92288 WP_003724827.1.9243 WP_003724827.1.92494 WP_003724827.1.92591 WP_003724827.1.9282 WP_003724827.1.92928 WP_003724827.1.93014 WP_003724827.1.93421 WP_003724827.1.93490 WP_003724827.1.93534 WP_003724827.1.93558 WP_003724827.1.93611 WP_003724827.1.93712 WP_003724827.1.93867 WP_003724827.1.94026 WP_003724827.1.94059 WP_003724827.1.94081 WP_003724827.1.94233 WP_003724827.1.94336 WP_003724827.1.94401 WP_003724827.1.94464 WP_003724827.1.94554 WP_003724827.1.94759 WP_003724827.1.9505 WP_003724827.1.95197 WP_003724827.1.95696 WP_003724827.1.96422 WP_003724827.1.96449 WP_003724827.1.96496 WP_003724827.1.96542 WP_003724827.1.96544 WP_003724827.1.96605 WP_003724827.1.96708 WP_003724827.1.96751 WP_003724827.1.96835 WP_003724827.1.97140 WP_003724827.1.97469 WP_003724827.1.97587 WP_003724827.1.9768 WP_003724827.1.9769 WP_003724827.1.97803 WP_003724827.1.98490 WP_003724827.1.98829 WP_003724827.1.98974 WP_003724827.1.99199 WP_003724827.1.99518 WP_003724827.1.99663 WP_003724827.1.99737 WP_003724827.1.99818 gi|424713780|ref|YP_007014495.1| gi|525723692|ref|YP_008285828.1| gi|405752120|ref|YP_006675585.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]