SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B8RPF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B8RPF6
Domain Number 1 Region: 72-200
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.98e-46
Family Regulator of G-protein signaling, RGS 0.00000883
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0B8RPF6
Sequence length 211
Comment (tr|A0A0B8RPF6|A0A0B8RPF6_BOIIR) Regulator of G-protein signaling 2-like protein {ECO:0000313|EMBL:JAG66799.1} OX=92519 OS=Boiga irregularis (Brown tree snake). GN= OC=Toxicofera; Serpentes; Colubroidea; Colubridae; Colubrinae; Boiga.
Sequence
MQSVMFLAFQHDRSRMEKSASRCQSKDEKKGKMKKTILKDWKARLNYFLQNSSNSTSAKA
NKKGQQKTCFRPSPEEAQLWSETFDELLANKYGLASFRAFLKSEFCEENIDFWLACEDYK
KIKSPQKLTAKAKKIYSDFIEKEAPKEINIDFQTKNSIAQSIEEATHTXFSAAQKRVYSL
MENNSYPRFLESEFYQELCRKSPISRDSQET
Download sequence
Identical sequences A0A0B8RPF6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]