SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B8RQS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B8RQS6
Domain Number 1 Region: 281-411
Classification Level Classification E-value
Superfamily ApaG-like 3.53e-40
Family ApaG-like 0.00022
Further Details:      
 
Domain Number 2 Region: 7-83
Classification Level Classification E-value
Superfamily F-box domain 1.83e-17
Family F-box domain 0.0045
Further Details:      
 
Domain Number 3 Region: 100-268
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.83e-17
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0B8RQS6
Sequence length 455
Comment (tr|A0A0B8RQS6|A0A0B8RQS6_BOIIR) F-box only protein 3-like protein {ECO:0000313|EMBL:JAG67949.1} OX=92519 OS=Boiga irregularis (Brown tree snake). GN= OC=Toxicofera; Serpentes; Colubroidea; Colubridae; Colubrinae; Boiga.
Sequence
MAAVAEQDLTTLSLEQLPTDPLLLILSFLDYKDLMSCCFVNRRLNQLSVHDPLWKRHCKK
YWLLSEAEKSXRTKSWKAIFIDMYADLGTYIQYYATLKKAWDDLEKYLLQHCPRMISSLK
DSVQEDDLDAVEAQIGCKLPDDYRCSFRIHNGQKLVVPGLMGSMALSNHYRSEDLLDIDT
AAGGFQQRLGLKQCLPLTFCIHTGLSQYMALESVEGRNKYEIFYQCPDQMARNPSAIDMF
ITGNSYLEWFTSYVNNVITGGYPIIRDQIFRYVHEKDCVAKTGDITVSVSTSFLPELSSV
HPPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGR
VYEYTSCTTFATTSGYMEGYYTFHCLYYKDKFFNVTIPRFHMVCPTFKVSIARMETNHND
CAMDDEEDSTDTDEYEERHRILGIPIPSGRCPRQT
Download sequence
Identical sequences A0A0B8RQS6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]