SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0B8T5M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0B8T5M1
Domain Number 1 Region: 53-167
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000824
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0B8T5M1
Sequence length 269
Comment (tr|A0A0B8T5M1|A0A0B8T5M1_9SPHI) Uncharacterized protein {ECO:0000313|EMBL:KGE15938.1} KW=Complete proteome; Reference proteome OX=1229276 OS=Sphingobacterium deserti. GN=DI53_0287 OC=Sphingobacteriaceae; Sphingobacterium.
Sequence
MAETTLICILEVDRKFFGSVSEENLELHDMTNLKIINTLKTASFTDEDGENYTLDFLDPL
SEAEIQELRESFPKKRIAAELLEIFQVTRGWDSAAFNMVYFNSIDEFGFWELSPHSITLG
HDGFGNYWVLDIDNNGDLGKVFFACHDPAVFMVHSQNLNEYLRHLLDFHENPIENYVNNF
QINTVPEVWQHNTNCTPKTDFLHIKPQFRDFLNEFEGDEWIIADLTSGENGVGFAWGKFG
PNQLVQRHPTDLIWVLKNRKKGFLGRLFG
Download sequence
Identical sequences A0A0B8T5M1
WP_037494583.1.97194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]