SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1BTT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1BTT3
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000314
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C1BTT3
Sequence length 141
Comment (tr|A0A0C1BTT3|A0A0C1BTT3_9MICC) Uncharacterized protein {ECO:0000313|EMBL:KIA71855.1} KW=Complete proteome OX=1534409 OS=Arthrobacter sp. MWB30. GN=ANMWB30_33730 OC=Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Arthrobacter.
Sequence
MTDMFLEKFRALVPKYLEDEWQEEDGLTPDELDDALAEHSFTIPLVLREFYLAIGGCEDL
MEAYHYFWDPEELEVDDEGFLMFLEDEDEQFTWGFRTADLSIPDPIVWRRNNARGQWKSE
EGTFSEFVFDMFEWAFNDDED
Download sequence
Identical sequences A0A0C1BTT3
WP_018776834.1.39064 WP_018776834.1.49231 WP_018776834.1.75912 WP_018776834.1.81669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]