SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1C4V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1C4V7
Domain Number 1 Region: 80-219,365-449
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000108
Family Ankyrin repeat 0.0093
Further Details:      
 
Domain Number 2 Region: 767-868
Classification Level Classification E-value
Superfamily POZ domain 0.00000785
Family BTB/POZ domain 0.016
Further Details:      
 
Domain Number 3 Region: 945-1132
Classification Level Classification E-value
Superfamily RNI-like 0.0000133
Family Cyclin A/CDK2-associated p19, Skp2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C1C4V7
Sequence length 1149
Comment (tr|A0A0C1C4V7|A0A0C1C4V7_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KIA76245.1} KW=Complete proteome OX=83552 OS=Parachlamydia acanthamoebae. GN=DB43_AP00010 OC=Parachlamydia.
Sequence
MQPSDFNPVSSSSSSSSSSSISATGKRKETASQVFETTAEKKPRPESPALNERVTAMSSD
QEIDPRLTFIQGTAIQSIPVNPLFDAIRRKDTEALINSLAGEGKFLFRNRDTQNKNIFHI
AAMSGSVEIFNILYKFASHYVSYDWRSDLLNGQDIFGNTPLSFANLLSSRLTYCFLQSGA
NPEIMNGRGVSVLSRNSELGHALFYYHLYAISNNENNYWIISQHMGQLSQRLLASPQSSP
ALRSLAYIWNMHGQYGLGALHSLFSPVLIVCSDGLVKIPQIFVDVLKMKSQKFRDACDDK
EVLESGIVKGHGAGNNREPIVFDKIDTESFEMLLEILFAPKANSRLMIHQLVHKMVNGVF
IDLLFDEQLIRDQEGKNILHRFVIAKNLNGFLKILEHINRADPQDFFGKCRRAALNIFDH
SEKTPLHYAENDPAFVVPLLKAGADPRYKMTNSSLLQVAGDQYNFIFLSMYYKHLLESKD
DFLDEMEVYVNNILADLRESPEETVPPAILCLAWIWEAFKDKHNGLRTLFQDVTIGCNDG
EAVIPKIFVEVLKHKSPAFLKSFGEGYPLSDIDLESFKKVIESLFSGKTFVALNSHLMLK
QLGSPPILYELLMDELLQFEKADNGRNIFHVTAINNDVRACKSFLGCLENPTTFFHERRL
KALNKPDVHGLRPLEYAMKSSDQLAALYISIGADTYKGRNVELNKNILAICRNYIQLSKQ
EKKQTRETLIEILESIAKAPEKYSPGHAGMANAWMKLSGDPKNAAKTLFANYTFSCTDGP
FVIPKIIVEALREKSPYFRGLLEGNFKENVHPDSISLSCMKVQNFEMIIKLLFAEDNCFR
EFDNALEIISIIDYLQLRELIKGSCSFLKMACEEYFSSDELTKPEAFANIAEIHRFADAL
QLDQIKAVILEFIEKRSNCSLLNKHFKEDFSRFQSSIELMREVPIRNLDFSGGYLTDNVL
EELNKIPTLSELNFVDCEIQLSNSAIEKLRTGELLPNLKIFSFVSLQHLEIFDQLMSIQR
FRFQVGDHLNLSMVKINFKHGHTEALIHSLARYLDHPALTHLDFDEGLLTTRKFRAICKI
KALKNLTFYGTSVKLDSSFLNLLRLQEIPNGLNKLEFIDCFISAQTLRELKKIEHFKIII
TNPKRPKNK
Download sequence
Identical sequences A0A0C1C4V7 F8KW24
gi|338174321|ref|YP_004651131.1| WP_013924268.1.86004 WP_013924268.1.96470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]