SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1GIC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1GIC7
Domain Number 1 Region: 4-139
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000011
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C1GIC7
Sequence length 233
Comment (tr|A0A0C1GIC7|A0A0C1GIC7_9FLAO) Uncharacterized protein {ECO:0000313|EMBL:KIA99784.1} KW=Complete proteome; Reference proteome OX=1566023 OS=Flavobacterium sp. KMS. GN=OA93_02885 OC=Flavobacteriaceae; Flavobacterium.
Sequence
MPLSDIETKNGFTYPIIYKEFFLDGMLNVGEYGPDWYSTVYPKLKENPTLLLHSYDFELL
NLKGVNEAIDELLDPEGYREIKEEFKFIPFGQSGAGDHYCFFVSEENNGENPIVFVWHDM
NEVNYLAKNMQDFVFRMLLTDMSDQDVYNDVSDEEFKDNLERVLKTHKKYLTDKQNDVLQ
TVFNRGIIDYEILLPKMKEAKRGLLTDVELKKTLAEVIPFDKMDSSFEYSRES
Download sequence
Identical sequences A0A0C1GIC7
WP_039111660.1.44163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]