SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1HTW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C1HTW2
Domain Number - Region: 7-120
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.0128
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C1HTW2
Sequence length 122
Comment (tr|A0A0C1HTW2|A0A0C1HTW2_STRCV) Toxin RelE {ECO:0000313|EMBL:KIC77518.1} KW=Complete proteome OX=76860 OS=Streptococcus constellatus. GN=RN79_07370 OC=Streptococcus; Streptococcus anginosus group.
Sequence
MKKLIFEFYTRPNGHNEFVEFYKSLPQKDREKLLATISMIQEHGLLTAQRMEWVKKLNSD
IFEIRSKVSSNIQRAIYFHAVDNRYIITHGFTKKTQKTPINEIKKAQVIKKEFEGEQKNE
NN
Download sequence
Identical sequences A0A0C1HTW2 A0A1E9XXC8 A0A2J9X6H5 G6A6A0
WP_003070840.1.26641 WP_003070840.1.58780 WP_003070840.1.63101 WP_003070840.1.79988 WP_003070840.1.9504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]