SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1IEE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1IEE4
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.96e-44
Family SMI1/KNR4-like 0.000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C1IEE4
Sequence length 135
Comment (tr|A0A0C1IEE4|A0A0C1IEE4_9PSED) Cell wall assembly protein {ECO:0000313|EMBL:KIC84463.1} KW=Complete proteome OX=1586081 OS=Pseudomonas sp. C5pp. GN=RR51_00815 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEEVIEQLREANEPVPVPLELPDEDLLVEIEEELFINIPFVFKEFLLTVSDVVYGSLEPV
TVTDPQSHTYLPDVAANAWDAGVPRDLIPLCQDGDNYYCVEEDGTVVLWDAEEEIVGEDS
WESVWHWARDVWLES
Download sequence
Identical sequences A0A059V003 A0A099N654 A0A0C1IEE4 A0A136QDK8 F8G0W8 L0FT19 V7DB76 V9V9S3
WP_013974843.1.1643 WP_013974843.1.23948 WP_013974843.1.28354 WP_013974843.1.35335 WP_013974843.1.35716 WP_013974843.1.56258 WP_013974843.1.57632 WP_013974843.1.65739 WP_013974843.1.71677 WP_013974843.1.7288 WP_013974843.1.7435 WP_013974843.1.80759 WP_013974843.1.95946 gi|339490082|ref|YP_004704610.1| gi|568184700|ref|YP_008957403.1| gi|568190073|ref|YP_008962766.1| gi|431805228|ref|YP_007232131.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]