SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1IVA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1IVA7
Domain Number 1 Region: 18-121
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000101
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C1IVA7
Sequence length 198
Comment (tr|A0A0C1IVA7|A0A0C1IVA7_9BACT) Uncharacterized protein {ECO:0000313|EMBL:KIC94444.1} KW=Complete proteome; Reference proteome OX=1349421 OS=Flavihumibacter solisilvae. GN=OI18_12635 OC=Chitinophagaceae; Flavihumibacter.
Sequence
MKQLLEALEVLLVKINAPLLYSLNEGLDGNNILDLERANGFELPSEIKELYKWKNGSNAD
YDPRIGGGFLFRSAILMPLTKAYAEYNYTISNQFDFYLDSYFPLFESLNEEFFVIDCDPE
SETFKMILSYQTKHVYLTAGAVPVYDSPQTMIESITRCFSEKAYYYTKINQFEVDYELED
EIKASLNPKARYLKSFNS
Download sequence
Identical sequences A0A0C1IVA7
WP_039140208.1.75827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]