SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1NIQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1NIQ0
Domain Number 1 Region: 13-122
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 9.81e-32
Family Bacterial S-adenosylmethionine decarboxylase 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C1NIQ0
Sequence length 132
Comment (tr|A0A0C1NIQ0|A0A0C1NIQ0_9PSEU) S-adenosylmethionine decarboxylase beta chain {ECO:0000256|HAMAP-Rule:MF_00464} KW=Complete proteome; Reference proteome OX=1515610 OS=Prauserella sp. Am3. GN=HQ32_04739 OC=Prauserella.
Sequence
MPTDCREVGVFSGTHVLAELDGVEPRLLDDDVLLRTTLASTLTEAGATVCDVIAHRFEPH
GVTVLAMLAESHASVHTYPEIGAAFVDVFTCGDQADPTRAVELLGAALGSAPPAMSTVRR
GHPAPQTATTGK
Download sequence
Identical sequences A0A0C1NIQ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]