SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1QJU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1QJU1
Domain Number 1 Region: 9-47,88-176
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.7e-21
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C1QJU1
Sequence length 267
Comment (tr|A0A0C1QJU1|A0A0C1QJU1_9RICK) Uncharacterized protein {ECO:0000313|EMBL:KIE05774.1} KW=Complete proteome OX=86105 OS=Candidatus Jidaibacter acanthamoeba. GN=NF27_CY00100 OC=Candidatus Midichloriaceae; Candidatus Jidaibacter.
Sequence
MNMKHIEVRKCKDPITIEEILEAEGTIGAKLPSDYVEHLLKYNGGHPDKDCYPLLEPLPY
YNRITKAEAKSYDSEIAWFYAIHDGEYSNLLREYKFDGDRLPKGLIAIGRNSFGDLICMS
VGMGNYGKVYFWTLEGSVQLGEEEPWWDNVFLIANSFTDFINSLYSSNIEGDEDTNFINI
HDKYSLPYYLNNGRKHAELMKSFFAKTPTEVEEFIVDKIEENNDLILKYEVPSEKKRYIR
YITDKTGKYKDAIEDMVDYSSQEKIDA
Download sequence
Identical sequences A0A0C1QJU1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]