SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1QNP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1QNP9
Domain Number 1 Region: 190-306
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.22e-27
Family Pentapeptide repeats 0.00088
Further Details:      
 
Domain Number 2 Region: 6-169
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.75e-26
Family Pentapeptide repeats 0.0016
Further Details:      
 
Domain Number 3 Region: 476-559
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 9.03e-19
Family Pentapeptide repeats 0.0049
Further Details:      
 
Domain Number 4 Region: 353-474
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000392
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C1QNP9
Sequence length 571
Comment (tr|A0A0C1QNP9|A0A0C1QNP9_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:KIE07129.1} KW=Complete proteome; Reference proteome OX=1479485 OS=Tolypothrix bouteillei VB521301. GN=DA73_0238820 OC=Bacteria; Cyanobacteria; Nostocales; Tolypothrichaceae; Tolypothrix.
Sequence
MNAVLVSSRWNSCEVTDSNFCGVNLHKAEVANTQINNVNLSYANLSHALFYRTYIEATDF
SNSNLSNTKLYISINNSNFTNANLTNVAIVGFQNSNLQYAQLRHARIESFTGTNLTGADL
SHADLTLTDFKDTILTHVNLQGANCDRTNFRGLDLSTVNLTNTSLKGLLYDLKTKFPPNT
SLEDAYLICAGTILNEQNLVRTNLQDAVLCYSELINIKLAYANLIKANLKGAILNGANLK
YANLKNANLNYVNLKNANLERTNLVNANLQGAILENTNLRFCDLRGANLKDTNLTGTSLK
EIIYNNQSVFPNGINLNEAYFSRKNTNYLAQLNSPVIKDKSPLIEALKRIQFEGEFYPGL
TREEIDEITKDLPFTFPEELYELYEWHNGMKEPRGWDQCFVSSKEFIRLQEAIQYTEALA
TSEYRSEYIKPNWFYAFAEGTDNSYAYVLVLGEEVATVLDFCPDSYSVSVAYSSITQMML
AKAFGQQVDFSGANLAGVDLSGFNLRCSKLSLTNLSGANLSHTNLEEADLRGACLHNANF
KGSIIKNADFTDVFFCQTIMPDGSIRNSEFA
Download sequence
Identical sequences A0A0C1QNP9
WP_038082259.1.41981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]