SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1R0B9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1R0B9
Domain Number 1 Region: 70-119
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000129
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C1R0B9
Sequence length 143
Comment (tr|A0A0C1R0B9|A0A0C1R0B9_9RICK) Uncharacterized protein {ECO:0000313|EMBL:KIE05750.1} KW=Complete proteome OX=86105 OS=Candidatus Jidaibacter acanthamoeba. GN=NF27_DA00140 OC=Candidatus Midichloriaceae; Candidatus Jidaibacter.
Sequence
MKRKYSSSDSDNNYPAGNIKKEKKSSLLEWQKEIIDNVIPELLKENKVDVVKNSLRFVFN
TAKKIESLSKYNNYQFFWWAIEHGNLELMKYFINHTTERGKFLLVCHNNYEVIEQFIDLI
AEKINKGYYRREITTDILNFYKY
Download sequence
Identical sequences A0A0C1R0B9
WP_039455528.1.96149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]