SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1R797 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1R797
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 5.89e-45
Family AadK C-terminal domain-like 0.00000975
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C1R797
Sequence length 137
Comment (tr|A0A0C1R797|A0A0C1R797_9CLOT) Streptomycin adenylyltransferase family protein {ECO:0000313|EMBL:KIE46371.1} KW=Complete proteome; Reference proteome OX=1418104 OS=Clostridium argentinense CDC 2741. GN=U732_1587 OC=Clostridium.
Sequence
MREYGDCCNEFWNVTPYVVKGLCREEILFAIDHLNQILRHELLRMISWNVGIETGFTLSV
DKNYKFLDKYIPDDLWNRLLSTYCKALFICHELFRKVSKEVAEVLGFVYTEYDKDIIRYT
KDLYNQYVSKIENGTKI
Download sequence
Identical sequences A0A0C1R797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]