SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1RDT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1RDT2
Domain Number 1 Region: 137-280
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.12e-52
Family AadK C-terminal domain-like 0.0000521
Further Details:      
 
Domain Number 2 Region: 1-134
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.47e-50
Family AadK N-terminal domain-like 0.0000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C1RDT2
Sequence length 290
Comment (tr|A0A0C1RDT2|A0A0C1RDT2_9CLOT) Streptomycin adenylyltransferase family protein {ECO:0000313|EMBL:KIE48481.1} KW=Complete proteome; Reference proteome OX=1418104 OS=Clostridium argentinense CDC 2741. GN=U732_4268 OC=Clostridium.
Sequence
MRTEQEMFNLILDIAKNDERIRAVIMNGSRTNPNAIKDIFQDYDIVYVVDETKSFRDQKN
WIDQFGERLYMQYPEESSYYPNDVENCYGWLIQFTDGNRLDLHVSTLSYVLKEIKGDRLC
RILLDKDKCLPKMPEETDEDYWVKKPLERQFFDTCNEYWWSLNNVAKGLWREEIPYVMDM
INYYVRPQLIRLLEWKVGFKTNFTVSAGKSGKYMYRWLGNEEWNTFLKTYPSGNIKDIWK
SVFIMCDLFNDIANEVSYNMSIIYNEAEANNSLKFLKDVYLLPKDAKEIY
Download sequence
Identical sequences A0A0C1RDT2
WP_039629718.1.22478 WP_039629718.1.91264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]