SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1UDN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1UDN7
Domain Number 1 Region: 1-51
Classification Level Classification E-value
Superfamily Rubredoxin-like 4.54e-24
Family Rubredoxin 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C1UDN7
Sequence length 52
Comment (tr|A0A0C1UDN7|A0A0C1UDN7_9CLOT) Rubredoxin {ECO:0000256|PIRNR:PIRNR000071} KW=Complete proteome; Reference proteome OX=1418104 OS=Clostridium argentinense CDC 2741. GN=U732_2505 OC=Clostridium.
Sequence
MKKYVCVVCGYVYDPAEGDPDNGVAPGTSWEDVPEEWLCPLCGVGKDQFEEE
Download sequence
Identical sequences A0A0C1UDN7
WP_069187817.1.22478 WP_069187817.1.91264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]