SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1UT89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1UT89
Domain Number 1 Region: 9-144
Classification Level Classification E-value
Superfamily MTH1598-like 1.27e-35
Family MTH1598-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C1UT89
Sequence length 144
Comment (tr|A0A0C1UT89|A0A0C1UT89_9BACT) Archease {ECO:0000313|EMBL:KIE59033.1} KW=Complete proteome OX=1202785 OS=Methylacidiphilum kamchatkense Kam1. GN=A946_03070 OC=Methylacidiphilaceae; Methylacidiphilum.
Sequence
MDKQPITSYRWETFSHMADIGIRGFGNSPEEALIAVSLALISVITDPQKVSPTSSVSITC
QDDSYDLLLYDWLNSLIFKMATENMLFSAFEVELRLPFLRGMAWGETIDREKHKPAVEVK
GATFTELFFGQNGNQWIAQCVVDV
Download sequence
Identical sequences A0A0C1UT89

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]