SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1UYZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1UYZ0
Domain Number 1 Region: 22-99,133-181
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000732
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C1UYZ0
Sequence length 217
Comment (tr|A0A0C1UYZ0|A0A0C1UYZ0_9CYAN) Glucan synthasis protein {ECO:0000313|EMBL:KIF37147.1} KW=Complete proteome; Reference proteome OX=1304833 OS=Hassallia byssoidea VB512170. GN=PI95_09840 OC=Bacteria; Cyanobacteria; Nostocales; Tolypothrichaceae; Hassallia.
Sequence
MDKLWQIRNKLTQLAILDTTFQIFGSESHQYQFNPCLEEAEIEAFEVKYNIRLPCEYRNF
LLEVGNGGTGPGYGLYRLPDLENESEITAIPSKENEGLLCKPFPLKEAWNDLSLMKDKAD
SESIPYFDSKFVQGTITIAHYGCGIYAILVITGEQKGKIWIDDRTNDGGIYPATLNFCHY
FHADDPDDFQSSEEEHEPLSFYDWYEDWLNQSLLQVL
Download sequence
Identical sequences A0A0C1UYZ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]