SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1X468 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1X468
Domain Number 1 Region: 151-297
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000209
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C1X468
Sequence length 325
Comment (tr|A0A0C1X468|A0A0C1X468_9ACTN) Cell wall assembly protein Knr4 {ECO:0000313|EMBL:KIF69543.1} KW=Complete proteome; Reference proteome OX=352211 OS=Streptomyces sp. AcH 505. GN=HY68_14670 OC=Streptomyces.
Sequence
MTTGRLGQQAAPPNAGYAGQVVQFPDPVRASRHPHGVRVDDRGFPDFVPYARAAAEIAEP
PEGFGVDELRLTDYVSANAALAAAGHELWDTIPPVATPHGWTWHHVPASRRLVLVPVEVK
ALLRHHGGLATTRVDHGKRGTRPLQETRPVHFGLPKGEVSVTERQLLGVEEDLGYRLPGA
YRSFLKAAGGCAPVGAALDPELGLLVDQPFFTVRDQAAVNDLVYVNKCLRDHLTKDHLGV
GFVQGGILAVKVRGERIGSVWFCAYDDARDQDGWSVQERVDRLLLPCGDDFDVFLQRLAG
NPPELETVANLMVDGGFAQAVPVEG
Download sequence
Identical sequences A0A0C1X468
WP_041988911.1.29322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]