SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1XP40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1XP40
Domain Number 1 Region: 37-178
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000458
Family SMI1/KNR4-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C1XP40
Sequence length 282
Comment (tr|A0A0C1XP40|A0A0C1XP40_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KIF70187.1} KW=Complete proteome; Reference proteome OX=352211 OS=Streptomyces sp. AcH 505. GN=HY68_19120 OC=Streptomyces.
Sequence
MKIYNWRPFLERWSADWADSPGARGRDGADEEILRNRWLGFGPVSEERIVALEDRLGKRL
PPTYRSFLATTDGWRPAGTPVYLLGTAEGVHRHGGSGMREEYESQLGENPSEEDVLLAGM
WDRALQLSVESDMIDVLLDPGDVNAEGEWAVYVYRGWSGEFPDRYESFMDVMQQLFRDFH
RNIENGGAADNETARELDAAVEEARLASLAGADVDEQLDVLTDAAAHGRGAAAELEGQVR
SMLGEQRESGQEYEAPGAFGRAVTAAREQARWGETEAAWQTI
Download sequence
Identical sequences A0A0C1XP40

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]