SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1YJW8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0C1YJW8
Domain Number - Region: 66-131
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0183
Family Apolipoprotein A-I 0.021
Further Details:      
 
Domain Number - Region: 26-79
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0262
Family Myosin rod fragments 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C1YJW8
Sequence length 147
Comment (tr|A0A0C1YJW8|A0A0C1YJW8_9VIBR) Membrane protein {ECO:0000313|EMBL:KIF45585.1} KW=Complete proteome OX=1344582 OS=Vibrio owensii 47666-1. GN=M445_21760 OC=Vibrionaceae; Vibrio.
Sequence
MPWIYAIVGLLVGTIVGVVISRLTTPEYKKQKSVQKELEAAKFELEQQRQELVDHFAQTA
EMLDTLGKDYTKLYQHMAKTSSELLPNLPEQDNPFDKKTAMSTEQIEEDQSNVNEQPKDY
ANGATGLLKDQEKEIIDAPEAVTAKAS
Download sequence
Identical sequences A0A061Q9Y0 A0A0C1YJW8 A0A0C1Z3L8 D0X7B5 K5U9Q0
WP_005436091.1.24139 WP_005436091.1.26610 WP_005436091.1.29144 WP_005436091.1.43523 WP_005436091.1.4555 WP_005436091.1.51142 WP_005436091.1.59835 WP_005436091.1.65646 WP_005436091.1.70465 WP_005436091.1.84855 WP_005436091.1.86147 WP_005436091.1.86250 WP_005436091.1.93958 WP_005436091.1.96035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]