SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C1ZCI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C1ZCI1
Domain Number 1 Region: 19-172
Classification Level Classification E-value
Superfamily RibA-like 2.35e-54
Family RibA-like 0.00000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C1ZCI1
Sequence length 198
Comment (tr|A0A0C1ZCI1|A0A0C1ZCI1_9VIBR) GTP cyclohydrolase II {ECO:0000256|HAMAP-Rule:MF_00179} KW=Complete proteome OX=1229493 OS=Vibrio owensii CAIM 1854 = LMG 25443. GN=H735_01295 OC=Vibrionaceae; Vibrio.
Sequence
MAEVRARVDFKVGAKSNIDAEILSFHGLKTDKEHVAIIFKQADQTQDMPLVRMHSECLTG
DVFHSSRCDCGEQLEETINRMGESGGIILYLRQEGRGIGLYNKIDAYRLQSQGMNTYEAN
NHLGFDDDLRDFTEAAQMLEALGVSKIRLVTNNPKKIRELSEYGIEISEVVNTSAHIKDG
NENYLKAKVSHGKHNLKV
Download sequence
Identical sequences A0A0C1YZA1 A0A0C1ZCI1 K5UDV4
WP_009706891.1.24139 WP_009706891.1.26610 WP_009706891.1.29144 WP_009706891.1.43523 WP_009706891.1.4555 WP_009706891.1.59835 WP_009706891.1.65646 WP_009706891.1.70465 WP_009706891.1.84855 WP_009706891.1.86147 WP_009706891.1.91833 WP_009706891.1.93958 WP_009706891.1.96035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]