SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2BBX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2BBX3
Domain Number 1 Region: 123-261
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000602
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C2BBX3
Sequence length 287
Comment (tr|A0A0C2BBX3|A0A0C2BBX3_9ACTN) Cell wall assembly protein Knr4 {ECO:0000313|EMBL:KIF78810.1} KW=Complete proteome; Reference proteome OX=1576605 OS=Streptomyces sp. 150FB. GN=QR77_14135 OC=Streptomyces.
Sequence
MDDDGYPVFAPYARAAAEIAEPPEGFGVDELRLTDYVSANAALAASGHELWNTIPAVATP
HGWTWHHEPASRRMVLVPVEVKALLRHHGGLATAPVDHAKRGTRPLQETRPSHFGLPKGS
LTVTEQQVLGVEEDLGYRLPGAYRSFLKAAGGCAPVGAALDAELGLLVDQPFFTVRDQAA
VNDLLYVNKCLRDHMTKDYLGVGFVQGGILAVKVRGERIGTVWFCPYDDARDHDGLGVQE
RVDRLLLPCGDDFDDFLRRLAGNPPELETVANLMVDGGFARVVPVEG
Download sequence
Identical sequences A0A0C2BBX3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]