SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2BW48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2BW48
Domain Number 1 Region: 3-75
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.000000000000632
Family Poly(A) polymerase, PAP, N-terminal domain 0.033
Further Details:      
 
Domain Number 2 Region: 63-102
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0000000000388
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C2BW48
Sequence length 103
Comment (tr|A0A0C2BW48|A0A0C2BW48_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KIH48188.1} KW=Complete proteome; Reference proteome OX=51022 OS=Ancylostoma duodenale. GN=ANCDUO_21746 OC=Ancylostoma.
Sequence
MQETANYLEEVGLAKSVAVFSDAFVPIVKMVEKDTLVNVDISFNTAQGVKAADYIEKVKE
EFPVVEPLILVLKQFLILRRLNTTYTGGLSSYGLILMLINFLH
Download sequence
Identical sequences A0A0C2BW48

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]