SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2C8R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2C8R8
Domain Number 1 Region: 34-79
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000702
Family B-box zinc-binding domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C2C8R8
Sequence length 127
Comment (tr|A0A0C2C8R8|A0A0C2C8R8_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KIH46112.1} KW=Complete proteome; Reference proteome OX=51022 OS=Ancylostoma duodenale. GN=ANCDUO_23837 OC=Ancylostoma.
Sequence
MVPELHQLCLLKRVVPHSGCDGLNKEKQRKDVVPSCTVHPTEQLLYCECCDLVFCQQCQA
TVINKKCTQHTVIPFSIALKRMSEIVVYRAKGRLRALDQAHECVSQEIDQLDKNVDKILD
QINSTFQ
Download sequence
Identical sequences A0A0C2C8R8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]