SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2CNY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2CNY1
Domain Number 1 Region: 5-70
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.79e-24
Family Transducin (alpha subunit), insertion domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C2CNY1
Sequence length 103
Comment (tr|A0A0C2CNY1|A0A0C2CNY1_9BILA) G-protein alpha subunit {ECO:0000313|EMBL:KIH58403.1} KW=Complete proteome; Reference proteome OX=51022 OS=Ancylostoma duodenale. GN=ANCDUO_11390 OC=Ancylostoma.
Sequence
MGEESEPLTDEVSKAIQSLWSDPGVKKAFEMRSEYQLTDSAKYFLDSCARVSEPGYRPSE
QDILYSRVATTGVVEVKFKIKELDFRWSLAFLPSSVSAGLSRT
Download sequence
Identical sequences A0A0C2CNY1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]