SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2DB18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2DB18
Domain Number 1 Region: 24-160
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.57e-24
Family Regulator of G-protein signaling, RGS 0.004
Further Details:      
 
Domain Number 2 Region: 160-294
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.31e-23
Family Regulator of G-protein signaling, RGS 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C2DB18
Sequence length 424
Comment (tr|A0A0C2DB18|A0A0C2DB18_9BILA) Regulator of G protein signaling domain protein {ECO:0000313|EMBL:KIH66923.1} KW=Complete proteome; Reference proteome OX=51022 OS=Ancylostoma duodenale. GN=ANCDUO_02750 OC=Ancylostoma.
Sequence
MDDACIEMSAEAHEESNIVRDSNVLAHSIDRILEDSSVMAFFIHFLESCDKLNLVKFWIH
VSGFKASFGNCPTGSSQKAEQSLALLDARNIYDRYIDKESSCSISLPKSISGRIQDRLQD
DCIAPEIFDEAKSFVRDVFETRYLKDFKNSVYYKKHLLQVLSRGCNLDDVLHVPALLNSF
LEFVDDQHDRDCIQFLLACNTFESSYDKLSDEELLEDAMCVYDRYLSMQALTSLLVGDNV
RQIVESEICSDTGRPLRSSFLSAKQFCMLRLSEKYLRKFVGSPYYQSYLIELETEVQNTV
ELPVANREVLRAGSSSSESLPITFDRTFEAPDCKRTPAISAQHSPLLAKRNRTLNLAEVD
CMGRYHVLYDDSLAQDSTAPSRLRQKLRKYLDKSTLKEEEVAVEVARTIIADVHNMVEAG
RKCL
Download sequence
Identical sequences A0A0C2DB18

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]