SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2DP26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2DP26
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000877
Family Regulator of G-protein signaling, RGS 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C2DP26
Sequence length 134
Comment (tr|A0A0C2DP26|A0A0C2DP26_9BILA) Regulator of G protein signaling domain protein {ECO:0000313|EMBL:KIH64417.1} KW=Complete proteome; Reference proteome OX=51022 OS=Ancylostoma duodenale. GN=ANCDUO_05272 OC=Ancylostoma.
Sequence
WAVEELKTVCSSESRPEFERTVLEMFETFIASESPLAINIDHDTRTDIIDRVENQDPSSF
PDNIYERAQAHVYRLMEKNSMGCRDLPKAFSFKNYGELVDCFSRFVHTPAYKEVAKKIGL
PQTFRFNEKITPAC
Download sequence
Identical sequences A0A0C2DP26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]