SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2DQX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2DQX8
Domain Number 1 Region: 26-188
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 3.01e-46
Family Nicotinic receptor ligand binding domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C2DQX8
Sequence length 211
Comment (tr|A0A0C2DQX8|A0A0C2DQX8_9BILA) Neurotransmitter-gated ion-channel ligand binding domain protein {ECO:0000313|EMBL:KIH65127.1} KW=Complete proteome; Reference proteome OX=51022 OS=Ancylostoma duodenale. GN=ANCDUO_04554 OC=Ancylostoma.
Sequence
MKYAVLVWCTFATVSGKIKQSAKDLEGQLYEDLLFDYNKIPRPVKNSSDILTVDVGASLI
RIIDVVICMSCKKAFTIINKVHEQKWFDAKLTWDPKKYGGLRTLHIPSDLIWTPDLVLYN
NAAGDPDITILTDALVTHEGHVFWQPPAIYKSFCPIDVTWFPYDSQKCEMKFGTWTYTGR
YVDLKQLPKGELAGVGVTTSDFNPMCSGPGK
Download sequence
Identical sequences A0A0C2DQX8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]