SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2F699 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2F699
Domain Number 1 Region: 370-468
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000101
Family Flavin-binding PAS domain 0.0033
Further Details:      
 
Domain Number 2 Region: 221-353
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000107
Family Regulator of G-protein signaling, RGS 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C2F699
Sequence length 866
Comment (tr|A0A0C2F699|A0A0C2F699_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KIH86523.1} KW=Complete proteome OX=1398154 OS=Sporothrix brasiliensis 5110. GN=SPBR_08151 OC=Sporothrix.
Sequence
MSSSPRKLSIQRPASALAKPSSGLDYQNARQPVALPTPPPSARSTKSASNRSERRRSLPA
QAPSSSGSAVSTPIDAYAYTLAKQPDELAHLDISGTLYERRRSSGPMSPTMSMSSVQSAA
SERGYERNSRGDRGRDRDSEQARTRSISSSAEETLSIHRLRSNSGLALHTNSAALRRYTD
YNADGSTRLPPTDERFDSDGRFGDETGDGGNRAPGAVAGTPTTPKLLSWETVRVVLDDPV
ARQRLMEYTRSVGGAENLDFLEMVEQYNKALHSVTALMANISTTYTCMTATEPLNLPQPL
SKSLNADVKHVSKSILPGLEMLFGDVNAHIQERVVRNIYPDFVKRQLMFRMKNSLGASSA
GAASTPFRFEGLGQAFCLTDPYRPDNPVVYASDSFAKVLGYNRSEDIPRTGRFFRGPEVS
NEDAFCEDLVLTRNHRDNRPFWSLVSGCPLKTASGRVRFVLSGLVDVTDAVKTQGDIVSA
LSAAAPAAAQPSPSHELTMPVHRDVNRPMGTITASHVASGRPQLSKQDKTEKPSSKSFFN
PFSRKKRTDTSAAPSSRGESAARFNLGSDVVSRSTPPVQPPMTTAVAPQINLSPPATPSL
DDTTSMYARFMVLQFVPGSSHGPDYSNPMPPPLSSSSRRNSRYGSSAGVTSAPHPSAFSS
VSRLKVAFSSLPMLDLLGLGPAAQEAVMYHDVFAVLSELAGSPSITPVFRANVRQRVVTS
ESASLELSIPASGVMAPGAVSAGLGAGLASPANASGGGGGDESGASTASRRSSLLLSGGR
SKRDSMDDEGMSSWDGSRVSEGRWPPSSRRKRSGTYERPGTGSGERRSGGVAAPPRLQRL
MSHWTPLKDVDGTVAWVILVMSPAVQ
Download sequence
Identical sequences A0A0C2F699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]