SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2FJ83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2FJ83
Domain Number 1 Region: 125-191
Classification Level Classification E-value
Superfamily BPTI-like 6.67e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.003
Further Details:      
 
Domain Number 2 Region: 231-296
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000109
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0064
Further Details:      
 
Domain Number 3 Region: 21-87
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000119
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C2FJ83
Sequence length 341
Comment (tr|A0A0C2FJ83|A0A0C2FJ83_9BILA) Kunitz/Bovine pancreatic trypsin inhibitor domain protein {ECO:0000313|EMBL:KIH46829.1} KW=Complete proteome; Reference proteome OX=51022 OS=Ancylostoma duodenale. GN=ANCDUO_23115 OC=Ancylostoma.
Sequence
MNPGVCPAGYYCHYGADTTTTVCCQALGNNPCAEPWTKGEGEAALTRFYYDALQRKCLAF
NYFGTKGNQNNFLTRESCEIACPVWVNPCAIGQPTLTSDQHPFRCHQGAPCSSGYYCHIG
FDESTTACCPSQGDPCSLIVKEGRGTQSIQRWFYNQKTRQCQPFTYKGMGGNENNFLLRE
HCESTCPVWVNACPQGEAYLLPTGRPQQCDPANEDSCPETHWCHPGPDSTTTMCCPGRVD
PCTRAKSEGEGPLQLTRYYFDASRRQCLQFSFRGIRGNANNFMTKESCEARCPVQVNPCP
LTMNSLSNSVTLTPCSGTKQCPETQWCHIGETKDTTVCCPN
Download sequence
Identical sequences A0A0C2FJ83

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]