SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2FPN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2FPN9
Domain Number 1 Region: 46-122
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.14e-25
Family Regulator of G-protein signaling, RGS 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C2FPN9
Sequence length 122
Comment (tr|A0A0C2FPN9|A0A0C2FPN9_9BILA) Regulator of G protein signaling domain protein {ECO:0000313|EMBL:KIH50505.1} KW=Complete proteome; Reference proteome OX=51022 OS=Ancylostoma duodenale. GN=ANCDUO_19416 OC=Ancylostoma.
Sequence
MMDIATSLHMLHDDSIEHHHSGPISKTISLIRNKLDVALSTSSLYPSRDEVRQWRHSFES
LLNHKYGCSLFREFLKKEFSDENVDFWLECEEFKKMKDGKKATIQKAHEIFKEYVAASAP
KE
Download sequence
Identical sequences A0A0C2FPN9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]