SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2FPW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2FPW3
Domain Number 1 Region: 1-58
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.00000000000000549
Family Neurotransmitter-gated ion-channel transmembrane pore 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C2FPW3
Sequence length 74
Comment (tr|A0A0C2FPW3|A0A0C2FPW3_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KIH48734.1} KW=Complete proteome; Reference proteome OX=51022 OS=Ancylostoma duodenale. GN=ANCDUO_21193 OC=Ancylostoma.
Sequence
MALTFQFGNIVKNLPRVSFVKAIDLWFFVCVAFIFFSLVELAVVGFVDKISEIKRRSKRL
RLQRAMHGGGPLKK
Download sequence
Identical sequences A0A0C2FPW3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]