SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2GCH3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2GCH3
Domain Number 1 Region: 15-90
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.00000942
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C2GCH3
Sequence length 94
Comment (tr|A0A0C2GCH3|A0A0C2GCH3_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KIH54726.1} KW=Complete proteome; Reference proteome OX=51022 OS=Ancylostoma duodenale. GN=ANCDUO_15126 OC=Ancylostoma.
Sequence
HYGMPVRRKHPYSPEVNLGELLMRFFEVYAQGYSHHGVTKHTLSEKRYPLEVNYDAVGIS
VIDMRYTPKEARRDGDKKAALLSIEDPLLIRVYI
Download sequence
Identical sequences A0A0C2GCH3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]