SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2GHS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2GHS4
Domain Number 1 Region: 55-160
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 0.0000000381
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C2GHS4
Sequence length 227
Comment (tr|A0A0C2GHS4|A0A0C2GHS4_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KIH60750.1} KW=Complete proteome; Reference proteome OX=51022 OS=Ancylostoma duodenale. GN=ANCDUO_08985 OC=Ancylostoma.
Sequence
MSKLITREVENLGIPVDSCVVLHQLRVPLLIIHLKNGQSIDVQFPDDQFQAIRNTNLIRH
YVQALTPWPVMPVLCKTHANLVGAQIPIDDVVSLLDSPHVSIEWNSHNQMSVSELAVRFV
DYYSNFDTSQHVIYIEKGLTSRRRQVSGEVHLLLVDPYSRMTVCVNLYADVVDTSGQFLD
SFPTFPEASLFRTQTKWQSWRVYSRERKVVVDKRMQDQSSEAELQDS
Download sequence
Identical sequences A0A0C2GHS4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]