SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2GN59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2GN59
Domain Number 1 Region: 91-226
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 4.71e-44
Family Poly(A) polymerase, PAP, middle domain 0.0000056
Further Details:      
 
Domain Number 2 Region: 17-89
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 8.99e-16
Family Poly(A) polymerase, PAP, N-terminal domain 0.00018
Further Details:      
 
Domain Number 3 Region: 224-268
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 0.0000000000000196
Family Poly(A) polymerase, PAP, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C2GN59
Sequence length 282
Comment (tr|A0A0C2GN59|A0A0C2GN59_9BILA) Poly(A) polymerase central domain protein {ECO:0000313|EMBL:KIH60509.1} KW=Complete proteome; Reference proteome OX=51022 OS=Ancylostoma duodenale. GN=ANCDUO_09241 OC=Ancylostoma.
Sequence
MALDKKDRENGAMASDENVTDLHAVEDAFVPVIKLKYAGIELDILFARLALKEVPDDQTL
NDDMLLKNLDDKSIRSLNGCRVADEILRLVPYPESFALCLRAVKLWAKNHGIYSNVLGFL
GGVTWAILVARTCQLYPNASPSKLLLKFFLVEWPLPVVLKDMDSANRPDIGNLQELVWDP
RIRGSDRFHLMPILTPAFPEQNSTFNVTNSTRSIMINEMKEALTCAAKNEEDHLIFCGFV
ESKIRHLIGALERNQGISLAHINPRQYKPLPGAISQFASGYE
Download sequence
Identical sequences A0A0C2GN59

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]