SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2IYV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2IYV6
Domain Number 1 Region: 13-64,182-263
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.05e-19
Family Regulator of G-protein signaling, RGS 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C2IYV6
Sequence length 378
Comment (tr|A0A0C2IYV6|A0A0C2IYV6_9PEZI) RGS domain protein (Rax1) {ECO:0000313|EMBL:KIH94296.1} KW=Complete proteome OX=1398154 OS=Sporothrix brasiliensis 5110. GN=SPBR_06009 OC=Sporothrix.
Sequence
MADFPGGHTPSPQPDLNRNRLPSLFEVLSRRTLPPVDLYSFYIYMRDQQRSVDYLDFWYV
PVAHPCGYLVSRFARLDVAQHMTLCRHYVRELRRSVLVVTPDGEKSASKRSSAILENLGD
MTHPVAGPSKYQSDKERDQDAQMSAFLREDLHPQDSPVSGPGQSPNPASTPRDITDSNSP
AHAVARQDIRASAEKILYTFLLPGAEREIILPGNITTDITTAIEEYGRDDPEVFDVAKDY
VFQAMERDAFPGFLRMKALGNLIPPTLILRLIIGMISMFGAFWTAFVLIFLDESRRTRLF
LILPFTFGVYFLASFQYSLDPVLALLGFSEYTPFHFSRVREPFVRRLLAKRALVVLAVTV
LVDAALLVLFILVPGRRL
Download sequence
Identical sequences A0A0C2IYV6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]