SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2JP27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2JP27
Domain Number 1 Region: 108-225
Classification Level Classification E-value
Superfamily LigB-like 0.000017
Family LigB-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C2JP27
Sequence length 226
Comment (tr|A0A0C2JP27|A0A0C2JP27_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KIH98567.1} KW=Complete proteome; Reference proteome OX=183763 OS=Streptomonospora alba. GN=LP52_12800 OC=Streptomonospora.
Sequence
MLIAAAVCPPSPLLVPQVAQGAAGELAGLRAACERAVDGLAASGADTVAVVGCGGADRVH
GPDAAGGLEAYGVPLRVGEGPPVLPLPLTVGRWLCERVGLRPDRYVEVAAAAAPRECAER
GADLAAAADRVALLVMGDGSARNGEYAPGTADERAPEFDAAVARALAGADTAALERVEPA
LAEELMCGGRAAWQVLAGAAKGAGLCGDLLAHEAPYGVGYFAALWR
Download sequence
Identical sequences A0A0C2JP27
WP_040273561.1.71031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]