SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2MZS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2MZS8
Domain Number 1 Region: 1-199
Classification Level Classification E-value
Superfamily Serpins 2.36e-35
Family Serpins 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C2MZS8
Sequence length 202
Comment (tr|A0A0C2MZS8|A0A0C2MZS8_THEKT) Alpha-2-antiplasmin {ECO:0000313|EMBL:KII67102.1} KW=Complete proteome; Reference proteome OX=669202 OS=Thelohanellus kitauei (Myxosporean). GN=RF11_00457 OC=Platysporina; Myxobolidae; Thelohanellus.
Sequence
MKFNASLTQPEIFFDEKGQPLEVDMMNQESFNLIYDSPDHDFRILFKSFKQTLLYSVIVL
PKEGHSFNDVLENFNITELLIYFKYSSMKYVQLKLPKFQIFRQNDLVKTLMFYGITDIFD
PNLSDFRRMTNHTVYIGNLIHITNIVIDEFGIRGAESPSTMDEEAVSQLYEFYVTRPFLF
FVYSPLETLVFFSAIVTNPSSG
Download sequence
Identical sequences A0A0C2MZS8
KII67102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]