SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2QBS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2QBS1
Domain Number 1 Region: 9-145
Classification Level Classification E-value
Superfamily Ribosomal protein L13 1.7e-58
Family Ribosomal protein L13 0.00000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C2QBS1
Sequence length 153
Comment (tr|A0A0C2QBS1|A0A0C2QBS1_9CYAN) 50S ribosomal protein L13 {ECO:0000256|HAMAP-Rule:MF_01366, ECO:0000256|RuleBase:RU003878, ECO:0000256|SAAS:SAAS00725370} KW=Complete proteome; Reference proteome OX=1245935 OS=Tolypothrix campylonemoides VB511288. GN=SD81_14905 OC=Bacteria; Cyanobacteria; Nostocales; Tolypothrichaceae; Tolypothrix.
Sequence
MTNNKTYLPPQDTQERNWYVVDATDQRLGRLASEIAIILRGKNKPEYTPHLDTGDFVIVV
NAEKVEVTGKKRTQKVYRRHSGRPGGMKTETFDKLQQRLPERIVEHAIKGMLPKNSLGRQ
LFTKLKVYAGPTHPHTAQQPKELKIQTIPGVQN
Download sequence
Identical sequences A0A0C2QBS1
WP_041036050.1.22965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]