SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2T4C1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2T4C1
Domain Number 1 Region: 9-152
Classification Level Classification E-value
Superfamily Ribosomal protein L13 9.29e-48
Family Ribosomal protein L13 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C2T4C1
Sequence length 200
Comment (tr|A0A0C2T4C1|A0A0C2T4C1_AMAMU) Uncharacterized protein {ECO:0000313|EMBL:KIL70745.1} KW=Complete proteome; Reference proteome OX=946122 OS=Amanita muscaria Koide BX008. GN=M378DRAFT_183340 OC=Agaricomycetes; Agaricomycetidae; Agaricales; Amanitaceae; Amanita.
Sequence
MATFSSTPIVIDGKGHLLGRLASILAKQILSGQKIVVVRCEEINISGSFFRNKLRYHNFL
HKRHIVNPKKCGPFHHRAPSKILYRAVRGMVPHKTARGAAALERLKLFEGIPPPYDRKKR
MVVPEALRVLRLKPGRKYCTVKRLSHEVGWGYKDVVDRLEEKRKIKAQAFHERKVAAIKL
RQKALGETARSFEKLTAVGY
Download sequence
Identical sequences A0A0C2T4C1
jgi|Amamu1|183340|fgenesh1_pm.2_#_149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]