SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2TS65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2TS65
Domain Number 1 Region: 14-146
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.44e-23
Family SMI1/KNR4-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C2TS65
Sequence length 150
Comment (tr|A0A0C2TS65|A0A0C2TS65_BACBA) Uncharacterized protein {ECO:0000313|EMBL:KIL78960.1} KW=Complete proteome; Reference proteome OX=1455 OS=Bacillus badius. GN=SD77_3761 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MNKSIWQTDNEGQQEPLTDEAVAKAEEILQVKLPESYIDILREQNGGYLLYDAYPTSVPT
SWADDHIHVDHLKGIGEGGILETGYLIEEWGLPKHIVLISGDGHTWIALDYRKTSENPPV
ILIEDDGETIIELAPDFLVFLEGLCQWEEE
Download sequence
Identical sequences A0A0C2TS65
WP_041113609.1.70146 WP_041113609.1.87026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]