SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2W9G5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2W9G5
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000432
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0C2W9G5
Sequence length 158
Comment (tr|A0A0C2W9G5|A0A0C2W9G5_RHOER) Uncharacterized protein {ECO:0000313|EMBL:KIM14847.1} KW=Complete proteome OX=1833 OS=Rhodococcus erythropolis (Arthrobacter picolinophilus). GN=QV65_28600 OC=Rhodococcus.
Sequence
MDSFRFPDRQGFPDSYRAFIRRAGWARTFGLWLIYPPVLPGFADGWQGRARNLTAHLHSV
YTEGQDDEFDWMIEPDGDWSLPDSLQVFGWSENGDALLWDTASRDTDGEFPVWESRSFNS
LHRLGGSLYEALPSIRTRTASLFGPRAYDIEPLQPTQL
Download sequence
Identical sequences A0A0C2W9G5
WP_037119881.1.69155 WP_037119881.1.98030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]