SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2X505 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2X505
Domain Number 1 Region: 160-264
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000445
Family Pseudo ankyrin repeat 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0C2X505
Sequence length 314
Comment (tr|A0A0C2X505|A0A0C2X505_9HOMO) Uncharacterized protein {ECO:0000313|EMBL:KIM33188.1} KW=Complete proteome; Reference proteome OX=933852 OS=Serendipita vermifera MAFF 305830. GN=M408DRAFT_61155 OC=Agaricomycetes; Sebacinales; Serendipitaceae; Serendipita.
Sequence
PLAHQLPLELVSQIMDHIGDWELSKSLGLTTSLKVPLAWGRATRLDLAILSLDMTKVKHT
PGPFYMCSAKAAIRFSAVQIIDYLFLKHRHCFDKTLGQILPANASLEGSIPVLRWWRDNY
AHIKPAGPAALDYASLNGHIAVLDWWLRESGLPLQYSEAALENASARGHLAVLHWWKSSG
LPLKIGRVMELASGAGHLAVLEFWHRSGLEFKYDKVPLQHASVSGRVDALEWWANSGLQM
IYDSDVLVGATRHNKPQTLEWWSRSGFPVQYRPCDIEEALEEATGGGAAVRKWWEKKGVD
FGANYAEWTKYQSL
Download sequence
Identical sequences A0A0C2X505
jgi|Sebve1|61155|e_gw1.2.169.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]