SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0C2XB86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0C2XB86
Domain Number 1 Region: 6-65
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0000000000000327
Family Preprotein translocase SecE subunit 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0C2XB86
Sequence length 70
Comment (tr|A0A0C2XB86|A0A0C2XB86_AMAMU) Uncharacterized protein {ECO:0000313|EMBL:KIL71677.1} KW=Complete proteome; Reference proteome OX=946122 OS=Amanita muscaria Koide BX008. GN=M378DRAFT_155272 OC=Agaricomycetes; Agaricomycetidae; Agaricales; Amanitaceae; Amanita.
Sequence
MSDKVREFIEIPQEFIRDGNQFLTRCTKPSQREFFQICRAVAVGFAVVGFIGYFVKLIHI
PINNILVGGA
Download sequence
Identical sequences A0A0C2XB86
jgi|Amamu1|155272|fgenesh1_kg.1_#_689_#_Locus3518v1rpkm64.70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]